endoplasmic reticulum câu

• The Endoplasmic Reticulum and the Golgi Complex
  mạng lưới nội sinh chất (endoplasmic reticulum-ER) và phức hợp Golgi của
• 00:34:18.01 the endoplasmic reticulum,
  Đó là mạng nội chất (endoplasmic reticulum),
• The endoplasmic reticulum also transports these molecules to their specific destinations either inside or outside the cell.
  Lưới nội chất cũng vận chuyển những phân tử này đến đích cụ thể của chúng hoặc trong hoặc ngoài tế bào.
• Once the preproinsulin reaches the endoplasmic reticulum, a protease cleaves off the signal peptide to create proinsulin.
  Proinsulin: Khi Preproinsulin tiến tới lưới nội chất, một protease chuyên biệt sẽ cắt bỏ đoạn peptide tín hiệu tạo proinsulin.
• This appeared to activate a particular stress pathway in the cells’ endoplasmic reticulum, which in turn revved up production of ROS.
  Việc này dường như đã kích hoạt một tín hiệu stress đặc biệt trong lưới nội chất của tế bào, từ đó làm tăng sản xuất ROS.
• The main regulatory mechanism for cholesterol biosyntheis is the sensing of intracellular cholesterol in the endoplasmic reticulum by the protein SREBP (Sterol Regulatory Element Binding Protein 1 and 2).
  Cơ chế điều hoà chính là phát hiện cholesterol nội bào ở hệ võng nội môi bởi protein SREBP (Sterol Regulatory Element Binding Protein 1 và 2).
• The main regulatory mechanism is the sensing of intracellular cholesterol in the endoplasmic reticulum by the protein SREBP (Sterol Regulatory Element Binding Protein 1 and 2).
  Cơ chế điều hoà chính là phát hiện cholesterol nội bào ở hệ võng nội môi bởi protein SREBP (Sterol Regulatory Element Binding Protein 1 và 2).
• The main regulatory mechanism is the sensing of intracellular cholesterol in the endoplasmic reticulum by the protein SREBP (sterol regulatory element-binding protein 1 and 2).
  Cơ chế điều hoà chính là phát hiện cholesterol nội bào ở hệ võng nội môi bởi protein SREBP (Sterol Regulatory Element Binding Protein 1 và 2).
• The team was able to confirm that, if a person carries the regular LSS gene, the enzyme appears in the endoplasmic reticulum.
  Nhóm nghiên cứu đã có thể khẳng định rằng, nếu một người mang gen LSS thông thường, thì enzyme sẽ xuất hiện trong lưới nội chất.
• Transport vesicles can move molecules between locations inside the cell, e.g. proteins from the rough endoplasmic reticulum to the Golgi apparatus.
  Túi vận chuyển (transport vesicle) có thể di chuyển những phân tử giữa các địa điểm trong tế bào, ví dụ: protein từ lưới nội chất hạt đến bộ máy Golgi.
• Transport vesicles can move molecules between locations inside the cell, e.g., proteins from the rough endoplasmic reticulum to the Golgi apparatus.
  Túi vận chuyển (transport vesicle) có thể di chuyển những phân tử giữa các địa điểm trong tế bào, ví dụ: protein từ lưới nội chất hạt đến bộ máy Golgi.
• Transport vesicles can move molecules between locations inside the cell, Example: proteins from the rough endoplasmic reticulum to the Golgi apparatus.
  Túi vận chuyển (transport vesicle) có thể di chuyển những phân tử giữa các địa điểm trong tế bào, ví dụ: protein từ lưới nội chất hạt đến bộ máy Golgi.
• (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL.[6][7] The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum.
  (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR ^ ^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG KR ^ NAVEVLKREPLNYLPL.[4][5] Peptide tín hiệu được loại bỏ trong quá trình dịch mã protein và vận chuyển vào mạng lưới nội chất.
• Already at the beginning of the 1970s he discovered that newly synthesized proteins have an intrinsic signal that is essential for governing them to and across the membrane of the endoplasmic reticulum, one of the cell’s organelles.
  Từ những năm 1970, ông đã khám phá ra rằng những protein mới tổng hợp có một tín hiệu nội tại thiết yếu để hướng dẫn chúng đi tới và vượt qua màng lưới của nội bào, một trong nhiều bào quan.
• In the next step, two additional carbon atoms are removed by the CYP17A enzyme in the endoplasmic reticulum to yield a variety of C19 steroids.[103] In addition, the 3-hydroxyl group is oxidized by 3-β-HSD to produce androstenedione.
  Trong bước tiếp theo, hai nguyên tử carbon bổ sung sẽ được xóa trước CYP17A enzyme trong lưới nội chất để mang lại một loạt các C 19 steroid.[136] Ngoài ra, nhóm 3-hydroxyl bị oxy hóa bởi 3-β-HSD để sản xuấtandrostenedione .
• To find out where the ROS were coming from, O’Riordan and her colleagues recently extracted macrophages from mice and used CRISPR-Cas9 to cut out the gene encoding IRE1α, a stress-sensing protein in the endoplasmic reticulum.
  Để tìm ra ROS đến từ đâu, O’Riordan và các đồng nghiệp của cô gần đây đã thu tách các đại thực bào từ chuột và sử dụng CRISPR-Cas9 để cắt bỏ gen mã hóa IRE1α, một protein cảm ứng stress trong mạng lưới nội chất.
• Also, SM treatment increased the ER stress by elevation of phosphorylated activating transcription factor 4 (p-ATF4), phosphorylated eukaryotic Initiation Factor 2 (p-eIF2), and phosphorylated protein kinase RNA-like endoplasmic reticulum kinase (p-PERK) expression.
  Ngoài ra, điều trị SM làm tăng ER stress bằng cách tăng biểu hiện của yếu tố phiên mã kích hoạt phosphoryl hóa 4 (p-ATF4), yếu tố khởi tạo eukaryotic phosphoryl hóa 2 (p-eIF2) và phosphorylated protein kinase RNA-like endoplasmic reticulum kinase (p-PERK).
• Also, SM treatment increased the ER stress by elevation of phosphorylated activating transcription factor 4 (p-ATF4), phosphorylated eukaryotic Initiation Factor 2 (p-eIF2), and phosphorylated protein kinase RNA-like endoplasmic reticulum kinase (p-PERK) expression.
  Ngoài ra, điều trị SM làm tăng ER stress bằng cách tăng biểu hiện của yếu tố phiên mã kích hoạt phosphoryl hóa 4 (p-ATF4), yếu tố khởi tạo eukaryotic phosphoryl hóa 2 (p-eIF2) và phosphorylated protein kinase RNA-like endoplasmic reticulum kinase (p-PERK).
• The team observed that the plants of different ages produced immunoglobulins (IgG) but not the IgG-HDEL, an antibody that forms in the endoplasmic reticulum.
  Người ta nghiên cứu những cây thuốc lá này với các nghiệm thức khác nhau về tuổi đối với kết quả sản sinh ra immunoglobulins (IgG) nhưng không sản sinh ra IgG-HDEL, một kháng thể tạo ra trong mạng võng nội chất (endoplasmic reticulum).
• The discovery follows another study Medical News Today reported in July 2015, where a team from the University of California-Davis suggests a biological process called endoplasmic reticulum stressis a significant driver of neuropathic pain.
  Phát hiện này theo một nghiên cứu khác được báo cáo vào tháng 7 năm 2015, khi một nhóm nghiên cứu từ Đại học California-Davis đề xuất một quá trình sinh học gọi là stress lưới nội chất là một nguyên nhân gây đau thần kinh quan trọng.